Lineage for d2a6cb2 (2a6c B:1-69)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709757Family a.35.1.13: NE1354 [140532] (2 proteins)
    contains extra C-terminal dimerisation arm (beta-strand)
    automatically mapped to Pfam PF13744
  6. 2709758Protein HTH-motif protein NE1354 [140533] (1 species)
  7. 2709759Species Nitrosomonas europaea [TaxId:915] [140534] (1 PDB entry)
    Uniprot Q82UW4 1-69
  8. 2709761Domain d2a6cb2: 2a6c B:1-69 [126237]
    Other proteins in same PDB: d2a6ca2, d2a6cb3
    automated match to d2a6ca1
    complexed with cit, edo, gol

Details for d2a6cb2

PDB Entry: 2a6c (more details), 1.9 Å

PDB Description: crystal structure of a putative transcriptional regulator (ne_1354) from nitrosomonas europaea at 1.90 a resolution
PDB Compounds: (B:) Helix-turn-helix motif

SCOPe Domain Sequences for d2a6cb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6cb2 a.35.1.13 (B:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]}
mkmrsqllivlqehlrnsgltqfkaaellgvtqprvsdlmrgkidlfsleslidmitsig
lkveinikd

SCOPe Domain Coordinates for d2a6cb2:

Click to download the PDB-style file with coordinates for d2a6cb2.
(The format of our PDB-style files is described here.)

Timeline for d2a6cb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a6cb3