PDB entry 2a6c

View 2a6c on RCSB PDB site
Description: crystal structure of a putative transcriptional regulator (ne_1354) from nitrosomonas europaea at 1.90 a resolution
Class: transcription
Keywords: putative transcriptional regulator, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, transcription
Deposited on 2005-07-02, released 2005-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Helix-turn-helix motif
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: np_841403.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82UW4 (12-End)
      • leader sequence (5-11)
      • modified residue (12)
      • modified residue (14)
      • modified residue (51)
      • modified residue (66)
    Domains in SCOPe 2.08: d2a6ca1, d2a6ca2
  • Chain 'B':
    Compound: Helix-turn-helix motif
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: np_841403.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82UW4 (12-End)
      • leader sequence (5-11)
      • modified residue (12)
      • modified residue (14)
      • modified residue (51)
      • modified residue (66)
    Domains in SCOPe 2.08: d2a6cb2, d2a6cb3
  • Heterogens: EDO, CIT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2a6cA (A:)
mgsdkihhhhhhmkmrsqllivlqehlrnsgltqfkaaellgvtqprvsdlmrgkidlfs
leslidmitsiglkveinikdaa

    Sequence, based on observed residues (ATOM records): (download) 
    >2a6cA (A:)
ihhhhhhmkmrsqllivlqehlrnsgltqfkaaellgvtqprvsdlmrgkidlfslesli
dmitsiglkveinikd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2a6cB (B:)
mgsdkihhhhhhmkmrsqllivlqehlrnsgltqfkaaellgvtqprvsdlmrgkidlfs
leslidmitsiglkveinikdaa

    Sequence, based on observed residues (ATOM records): (download) 
    >2a6cB (B:)
ihhhhhhmkmrsqllivlqehlrnsgltqfkaaellgvtqprvsdlmrgkidlfslesli
dmitsiglkveinikd