![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.13: NE1354 [140532] (2 proteins) contains extra C-terminal dimerisation arm (beta-strand) automatically mapped to Pfam PF13744 |
![]() | Protein HTH-motif protein NE1354 [140533] (1 species) |
![]() | Species Nitrosomonas europaea [TaxId:915] [140534] (1 PDB entry) Uniprot Q82UW4 1-69 |
![]() | Domain d2a6ca1: 2a6c A:1-69 [126236] Other proteins in same PDB: d2a6ca2, d2a6cb3 complexed with cit, edo, gol |
PDB Entry: 2a6c (more details), 1.9 Å
SCOPe Domain Sequences for d2a6ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} mkmrsqllivlqehlrnsgltqfkaaellgvtqprvsdlmrgkidlfsleslidmitsig lkveinikd
Timeline for d2a6ca1: