![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [419332] (8 PDB entries) Uniprot Q53239 |
![]() | Domain d2a3ta1: 2a3t A:44-193 [126096] Other proteins in same PDB: d2a3ta2 automated match to d2a3ta1 complexed with cu, mg |
PDB Entry: 2a3t (more details), 1.85 Å
SCOPe Domain Sequences for d2a3ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a3ta1 b.6.1.3 (A:44-193) Nitrite reductase, NIR, N-terminal domain {Rhodobacter sphaeroides [TaxId: 1063]} lprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsipgpl mivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatragaf vyhcapggpmipwhvvsgmagcimvlprdg
Timeline for d2a3ta1: