Lineage for d2a3ta1 (2a3t A:44-193)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771729Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)
  7. 2771929Species Rhodobacter sphaeroides [TaxId:1063] [419332] (8 PDB entries)
    Uniprot Q53239
  8. 2771936Domain d2a3ta1: 2a3t A:44-193 [126096]
    Other proteins in same PDB: d2a3ta2
    automated match to d2a3ta1
    complexed with cu, mg

Details for d2a3ta1

PDB Entry: 2a3t (more details), 1.85 Å

PDB Description: cu-containing nitrite reductase
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2a3ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3ta1 b.6.1.3 (A:44-193) Nitrite reductase, NIR, N-terminal domain {Rhodobacter sphaeroides [TaxId: 1063]}
lprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsipgpl
mivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatragaf
vyhcapggpmipwhvvsgmagcimvlprdg

SCOPe Domain Coordinates for d2a3ta1:

Click to download the PDB-style file with coordinates for d2a3ta1.
(The format of our PDB-style files is described here.)

Timeline for d2a3ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a3ta2