PDB entry 2a3t

View 2a3t on RCSB PDB site
Description: Cu-containing nitrite reductase
Class: oxidoreductase
Keywords: copper protein, nitrite reduction, denitrification, OXIDOREDUCTASE
Deposited on 2005-06-27, released 2005-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: nirK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53239 (0-327)
      • see remark 999 (186)
      • see remark 999 (237)
      • see remark 999 (275)
      • see remark 999 (307)
      • see remark 999 (323-324)
    Domains in SCOPe 2.08: d2a3ta1, d2a3ta2
  • Heterogens: CU, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3tA (A:)
    lprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsipgpl
    mivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatragaf
    vyhcapggpmipwhvvsgmagcimvlprdglkdhegkpvrydtvyyigesdhyipkdedg
    tymrfsdpsegyedmvavmdtlipshivfngavgaltgegalkakvgdnvlfvhsqpnrd
    srphligghgdlvwetgkfhnaperdletwfirggsagaalykflqpgvyayvnhnliea
    vhkgatahvlvegewdndlmeqvvapvg