Lineage for d2a3ta2 (2a3t A:194-371)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [419333] (8 PDB entries)
    Uniprot Q53239
  8. Domain d2a3ta2: 2a3t A:194-371 [126097]
    Other proteins in same PDB: d2a3ta1
    automated match to d2a3ta2
    complexed with cu, mg

Details for d2a3ta2

PDB Entry: 2a3t (more details), 1.85 Å

PDB Description: cu-containing nitrite reductase
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2a3ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3ta2 b.6.1.3 (A:194-371) Nitrite reductase, NIR, C-terminal domain {Rhodobacter sphaeroides [TaxId: 1063]}
lkdhegkpvrydtvyyigesdhyipkdedgtymrfsdpsegyedmvavmdtlipshivfn
gavgaltgegalkakvgdnvlfvhsqpnrdsrphligghgdlvwetgkfhnaperdletw
firggsagaalykflqpgvyayvnhnlieavhkgatahvlvegewdndlmeqvvapvg

SCOPe Domain Coordinates for d2a3ta2 are not available.

Timeline for d2a3ta2:

Domains from same chain:
(mouse over for more information)
d2a3ta1