SCOPe 2.04: Domain d2a2ia_: 2a2i A:

Lineage for d2a2ia_ (2a2i A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)

6. Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (4 species)

7. Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries)

8. Domain d2a2ia_: 2a2i A: [126031]
   automated match to d1pe1a_
   complexed with a5p, pep, zn

Details for d2a2ia_

PDB Entry: 2a2i, 1.95 Å

PDB Description: aquifex aeolicus kdo8ps in complex with pep, a5p, zn2+

PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d2a2ia_:

Sequence; same for both SEQRES and ATOM records:

>d2a2ia_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
qlegiieaileirevaskyyeti

Timeline for d2a2ia_:

• d2a2ia_ first appeared in SCOP 1.73, called d2a2ia1
  
• d2a2ia_ appears in SCOPe 2.03
  
• d2a2ia_ appears in SCOPe 2.05
  
• d2a2ia_ appears in the current release, SCOPe 2.08