Lineage for d2a2ia_ (2a2i A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835534Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 2835611Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (5 species)
  7. 2835612Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries)
  8. 2835701Domain d2a2ia_: 2a2i A: [126031]
    automated match to d1pe1a_
    complexed with a5p, pep, zn

Details for d2a2ia_

PDB Entry: 2a2i (more details), 1.95 Å

PDB Description: aquifex aeolicus kdo8ps in complex with pep, a5p, zn2+
PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d2a2ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2ia_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
qlegiieaileirevaskyyeti

SCOPe Domain Coordinates for d2a2ia_:

Click to download the PDB-style file with coordinates for d2a2ia_.
(The format of our PDB-style files is described here.)

Timeline for d2a2ia_: