SCOP 1.73: Domain d2a2ia1: 2a2i A:1002-1264

Lineage for d2a2ia1 (2a2i A:1002-1264)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)

6. Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [63922] (18 PDB entries)

8. Domain d2a2ia1: 2a2i A:1002-1264 [126031]
   automatically matched to d1pe1a_
   complexed with a5p, pep, zn

Details for d2a2ia1

PDB Entry: 2a2i, 1.95 Å

PDB Description: aquifex aeolicus kdo8ps in complex with pep, a5p, zn2+

PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOP Domain Sequences for d2a2ia1:

Sequence; same for both SEQRES and ATOM records:

>d2a2ia1 c.1.10.4 (A:1002-1264) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
qlegiieaileirevaskyyeti

Timeline for d2a2ia1:

• d2a2ia1 is new in SCOP 1.73
  
• d2a2ia1 appears in SCOP 1.75
  
• d2a2ia1 appears in the current release, SCOPe 2.08, called d2a2ia_