SCOPe 2.08: Domain d2a1ta1: 2a1t A:242-395

Lineage for d2a1ta1 (2a1t A:242-395)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225243] (4 PDB entries)

8. Domain d2a1ta1: 2a1t A:242-395 [126005]
   Other proteins in same PDB: d2a1ta2, d2a1tb2, d2a1tc2, d2a1td2, d2a1tr1, d2a1tr2, d2a1ts1
   automated match to d1egda1
   complexed with amp, fad

Details for d2a1ta1

PDB Entry: 2a1t, 2.8 Å

PDB Description: structure of the human mcad:etf e165betaa complex

PDB Compounds: (A:) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor

SCOPe Domain Sequences for d2a1ta1:

Sequence; same for both SEQRES and ATOM records:

>d2a1ta1 a.29.3.0 (A:242-395) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyegtsqiqrlivarehidkyk

Timeline for d2a1ta1:

• d2a1ta1 first appeared in SCOP 1.73
  
• d2a1ta1 appears in SCOPe 2.07