Lineage for d2a1ta1 (2a1t A:242-395)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708584Species Human (Homo sapiens) [TaxId:9606] [225243] (4 PDB entries)
  8. 2708599Domain d2a1ta1: 2a1t A:242-395 [126005]
    Other proteins in same PDB: d2a1ta2, d2a1tb2, d2a1tc2, d2a1td2, d2a1tr1, d2a1tr2, d2a1ts1
    automated match to d1egda1
    complexed with amp, fad

Details for d2a1ta1

PDB Entry: 2a1t (more details), 2.8 Å

PDB Description: structure of the human mcad:etf e165betaa complex
PDB Compounds: (A:) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor

SCOPe Domain Sequences for d2a1ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1ta1 a.29.3.0 (A:242-395) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyegtsqiqrlivarehidkyk

SCOPe Domain Coordinates for d2a1ta1:

Click to download the PDB-style file with coordinates for d2a1ta1.
(The format of our PDB-style files is described here.)

Timeline for d2a1ta1: