Lineage for d2a1ta1 (2a1t A:242-395)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639849Fold a.29: Bromodomain-like [47363] (10 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 639872Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 639873Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 proteins)
  6. 639913Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species)
  7. 639914Species Human (Homo sapiens) [TaxId:9606] [47209] (5 PDB entries)
  8. 639923Domain d2a1ta1: 2a1t A:242-395 [126005]
    Other proteins in same PDB: d2a1ta2, d2a1tb2, d2a1tc2, d2a1td2, d2a1tr1, d2a1tr2, d2a1ts1
    automatically matched to d1egca1
    complexed with amp, fad; mutant

Details for d2a1ta1

PDB Entry: 2a1t (more details), 2.8 Å

PDB Description: structure of the human mcad:etf e165betaa complex
PDB Compounds: (A:) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor

SCOP Domain Sequences for d2a1ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1ta1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyegtsqiqrlivarehidkyk

SCOP Domain Coordinates for d2a1ta1:

Click to download the PDB-style file with coordinates for d2a1ta1.
(The format of our PDB-style files is described here.)

Timeline for d2a1ta1: