Lineage for d2a1ts1 (2a1t S:3-250)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861418Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 2861440Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
    binds AMP
  7. 2861441Species Human (Homo sapiens) [TaxId:9606] [81390] (3 PDB entries)
    Uniprot P38117
  8. 2861444Domain d2a1ts1: 2a1t S:3-250 [126015]
    Other proteins in same PDB: d2a1ta1, d2a1ta2, d2a1tb1, d2a1tb2, d2a1tc1, d2a1tc2, d2a1td1, d2a1td2, d2a1tr1, d2a1tr2
    complexed with amp, fad

Details for d2a1ts1

PDB Entry: 2a1t (more details), 2.8 Å

PDB Description: structure of the human mcad:etf e165betaa complex
PDB Compounds: (S:) Electron transfer flavoprotein beta-subunit

SCOPe Domain Sequences for d2a1ts1:

Sequence, based on SEQRES records: (download)

>d2a1ts1 c.26.2.3 (S:3-250) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]}
elrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevi
avscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvll
gkqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkveraidggletlrlklpavvt
adlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkvett
edlvaklk

Sequence, based on observed residues (ATOM records): (download)

>d2a1ts1 c.26.2.3 (S:3-250) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]}
elrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevi
avscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvll
gkqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkveraidggletlrlklpavvt
adlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppttedlvaklk

SCOPe Domain Coordinates for d2a1ts1:

Click to download the PDB-style file with coordinates for d2a1ts1.
(The format of our PDB-style files is described here.)

Timeline for d2a1ts1: