SCOPe 2.08: Domain d1zz8a2: 1zz8 A:77-198

Lineage for d1zz8a2 (1zz8 A:77-198)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.10: TM1459-like [101976] (3 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [141594] (14 PDB entries)
   Uniprot Q56185 77-198

8. Domain d1zz8a2: 1zz8 A:77-198 [125881]
   Other proteins in same PDB: d1zz8a1, d1zz8b1, d1zz8c1
   automated match to d1zz6a2
   complexed with fe2, s0h

Details for d1zz8a2

PDB Entry: 1zz8, 2.3 Å

PDB Description: Crystal Structure of FeII HppE in Complex with Substrate Form 2

PDB Compounds: (A:) Hydroxypropylphosphonic Acid Epoxidase

SCOPe Domain Sequences for d1zz8a2:

Sequence; same for both SEQRES and ATOM records:

>d1zz8a2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

Timeline for d1zz8a2:

• d1zz8a2 first appeared in SCOP 1.73
  
• d1zz8a2 appears in SCOPe 2.07