Lineage for d1zz8c1 (1zz8 C:6-76)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
    Uniprot Q56185 6-76
  8. Domain d1zz8c1: 1zz8 C:6-76 [125884]
    Other proteins in same PDB: d1zz8a2, d1zz8b2, d1zz8c2
    automated match to d1zz6a1
    complexed with fe2, s0h

Details for d1zz8c1

PDB Entry: 1zz8 (more details), 2.3 Å

PDB Description: Crystal Structure of FeII HppE in Complex with Substrate Form 2
PDB Compounds: (C:) Hydroxypropylphosphonic Acid Epoxidase

SCOPe Domain Sequences for d1zz8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zz8c1 a.35.1.3 (C:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

SCOPe Domain Coordinates for d1zz8c1 are not available.

Timeline for d1zz8c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zz8c2
View in 3D
Domains from other chains:
(mouse over for more information)
d1zz8a1, d1zz8a2, d1zz8b1, d1zz8b2