Lineage for d1zz8b2 (1zz8 B:77-198)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. Family b.82.1.10: TM1459-like [101976] (3 proteins)
  6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)
  7. Species Streptomyces wedmorensis [TaxId:43759] [141594] (14 PDB entries)
    Uniprot Q56185 77-198
  8. Domain d1zz8b2: 1zz8 B:77-198 [125883]
    Other proteins in same PDB: d1zz8a1, d1zz8b1, d1zz8c1
    automated match to d1zz6a2
    complexed with fe2, s0h

Details for d1zz8b2

PDB Entry: 1zz8 (more details), 2.3 Å

PDB Description: Crystal Structure of FeII HppE in Complex with Substrate Form 2
PDB Compounds: (B:) Hydroxypropylphosphonic Acid Epoxidase

SCOPe Domain Sequences for d1zz8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zz8b2 b.82.1.10 (B:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

SCOPe Domain Coordinates for d1zz8b2 are not available.

Timeline for d1zz8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zz8b1
View in 3D
Domains from other chains:
(mouse over for more information)
d1zz8a1, d1zz8a2, d1zz8c1, d1zz8c2