SCOP 1.75: Domain d1zyro1: 1zyr O:2-96

Lineage for d1zyro1 (1zyr O:2-96)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein)
   4 helices; irregular array

6. Protein RNA polymerase omega subunit [63564] (3 species)

7. Species Thermus thermophilus [TaxId:274] [74729] (9 PDB entries)
   Uniprot Q8RQE7; part of multichain biological unit

8. Domain d1zyro1: 1zyr O:2-96 [125865]
   Other proteins in same PDB: d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrc1, d1zyrd1, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk1, d1zyrk2, d1zyrl1, d1zyrl2, d1zyrm1, d1zyrn1, d1zyrp1, d1zyrp2, d1zyrp3
   automatically matched to d1iw7e_
   complexed with mg, std, zn

Details for d1zyro1

PDB Entry: 1zyr, 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin

PDB Compounds: (O:) DNA-directed RNA polymerase omega chain

SCOP Domain Sequences for d1zyro1:

Sequence; same for both SEQRES and ATOM records:

>d1zyro1 a.143.1.1 (O:2-96) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

Timeline for d1zyro1:

• d1zyro1 first appeared in SCOP 1.73
  
• d1zyro1 appears in SCOPe 2.01
  
• d1zyro1 appears in the current release, SCOPe 2.08, called d1zyro_