PDB entry 1zyr

View 1zyr on RCSB PDB site
Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin
Class: transcription,transferase
Keywords: RNA polymerase; streptolydigin; transcription; holoenzyme
Deposited on 2005-06-10, released 2005-09-13
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.261
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zyra1, d1zyra2
  • Chain 'B':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zyrb1, d1zyrb2
  • Chain 'C':
    Compound: DNA-directed RNA polymerase beta chain
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zyrc1
  • Chain 'D':
    Compound: DNA-directed RNA polymerase subunit beta' chain
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zyrd1
  • Chain 'E':
    Compound: DNA-directed RNA polymerase omega chain
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zyre1
  • Chain 'F':
    Compound: DNA-directed RNA polymerase sigma chain
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zyrf1, d1zyrf2, d1zyrf3
  • Chain 'K':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zyrk1, d1zyrk2
  • Chain 'L':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zyrl1, d1zyrl2
  • Chain 'M':
    Compound: DNA-directed RNA polymerase beta chain
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zyrm1
  • Chain 'N':
    Compound: DNA-directed RNA polymerase subunit beta' chain
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zyrn1
  • Chain 'O':
    Compound: DNA-directed RNA polymerase omega chain
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zyro1
  • Chain 'P':
    Compound: DNA-directed RNA polymerase sigma chain
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zyrp1, d1zyrp2, d1zyrp3
  • Heterogens: STD, ZN, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zyrA (A:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyrA (A:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zyrB (B:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyrB (B:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zyrC (C:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zyrD (D:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvk
    dgeevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpge
    ilaelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivek
    gqplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegar
    veagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdv
    ladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlk
    yvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweli
    qldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeek
    kqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradi
    eaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvi
    elfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyve
    agqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyve
    vtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieeark
    eaveakerpaarrgvkreqpgkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyrD (D:)
    kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
    kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
    eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
    geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
    laelpepylfgdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgd
    rvapgdvladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldleal
    ekelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
    rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtn
    pgsdrplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
    kpfllkkmeekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
    qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
    sgeplakpsrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagre
    tsvgrlkyvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavede
    kvaweliqldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigidd
    avipeekkqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfee
    nypfnplyvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfis
    shgarkggadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslr
    lrkradieaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrsplt
    cqtrygvcqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaadit
    qglprvielfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllv
    kdgdyveagqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvr
    qmmkyvevtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstks
    wlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlk
    aieearkeavea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zyrE (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    etwamkelltgrlvfgenlvpedrlqkemeriypgeree
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyrE (E:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
    twamkelltgrlvfgenlvpedrlqkemeriypge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1zyrF (F:)
    mkkskrknaqaqeaqetevlvqeeaeelpefpegepdpdledpdlaleddlldlpeegeg
    ldleeeeedlpipkistsdpvrqylheigqvplltleeevelarkveegmeaikklseit
    gldpdlirevvrakilgsarvrhipglketldpktveeidqklkslpkehkrylhiareg
    eaarqhlieanlrlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyat
    wwirqainraiadqartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwd
    akrveetlkiaqepvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsk
    lsereamvlklrkglidgrehtleevgaffgvtrerirqienkalrklkyhesrtrklrd
    fld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyrF (F:)
    kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
    kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
    lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
    qartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqe
    pvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrk
    glidgeevgaffgvtrerirqienkalrklkyhesrtrklrdfld
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1zyrK (K:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyrK (K:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1zyrL (L:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyrL (L:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zyrM (M:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1zyrN (N:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvk
    dgeevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpge
    ilaelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivek
    gqplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegar
    veagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdv
    ladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlk
    yvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweli
    qldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeek
    kqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradi
    eaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvi
    elfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyve
    agqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyve
    vtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieeark
    eaveakerpaarrgvkreqpgkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyrN (N:)
    kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
    kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
    eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
    geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
    laelpepylfgdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgd
    rvapgdvladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldleal
    ekelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
    rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtn
    pgsdrplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
    kpfllkkmeekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
    qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
    sgeplakpsrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagre
    tsvgrlkyvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavede
    kvaweliqldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigidd
    avipeekkqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfee
    nypfnplyvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfis
    shgarkggadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslr
    lrkradieaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrsplt
    cqtrygvcqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaadit
    qglprvielfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllv
    kdgdyveagqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvr
    qmmkyvevtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstks
    wlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlk
    aieearkeavea
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1zyrO (O:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    etwamkelltgrlvfgenlvpedrlqkemeriypgeree
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyrO (O:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
    twamkelltgrlvfgenlvpedrlqkemeriypge
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1zyrP (P:)
    mkkskrknaqaqeaqetevlvqeeaeelpefpegepdpdledpdlaleddlldlpeegeg
    ldleeeeedlpipkistsdpvrqylheigqvplltleeevelarkveegmeaikklseit
    gldpdlirevvrakilgsarvrhipglketldpktveeidqklkslpkehkrylhiareg
    eaarqhlieanlrlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyat
    wwirqainraiadqartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwd
    akrveetlkiaqepvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsk
    lsereamvlklrkglidgrehtleevgaffgvtrerirqienkalrklkyhesrtrklrd
    fld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyrP (P:)
    kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
    kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
    lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
    qartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqe
    pvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrk
    glidgeevgaffgvtrerirqienkalrklkyhesrtrklrdfld