Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
Protein Anthrax toxin lethal factor, middle domain [69845] (1 species) includes an all-alpha insert subdomain |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69846] (9 PDB entries) |
Domain d1zxvb3: 1zxv B:264-550 [125802] Other proteins in same PDB: d1zxva1, d1zxva2, d1zxvb1, d1zxvb2 automated match to d1j7nb3 complexed with mfm, zn |
PDB Entry: 1zxv (more details), 2.67 Å
SCOPe Domain Sequences for d1zxvb3:
Sequence, based on SEQRES records: (download)
>d1zxvb3 d.166.1.1 (B:264-550) Anthrax toxin lethal factor, middle domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mlsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriq idssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldi qpydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmni nnltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwri qlspdtragylengklilqrnigleikdvqiikqsekeyiridakvv
>d1zxvb3 d.166.1.1 (B:264-550) Anthrax toxin lethal factor, middle domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mlsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriq idssdflsteekeflkklqidirdsdssnplsekekeflkklkldiqpydinqrlqdtgg lidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmninnltatlgadlvds tdntkinrgifnefkknfkysissnymivdinerpaldnerlkwriqlspdtragyleng klilqrnigleikdvqiikqsekeyiridakvv
Timeline for d1zxvb3: