![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.129: TBP-like [55944] (10 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (7 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.5: AHSA1 domain [111168] (7 proteins) Pfam PF05146 |
![]() | Protein Calicheamicin gene cluster protein CalC [143831] (1 species) possible link between the AHSA1 (Pfam PF08327) and oligoketide cyclase/dehydrase-like (new Pfam 03364) families |
![]() | Species Micromonospora echinospora [TaxId:1877] [143832] (3 PDB entries) |
![]() | Domain d1zxfa1: 1zxf A:1-155 [125771] |
PDB Entry: 1zxf (more details)
SCOP Domain Sequences for d1zxfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxfa1 d.129.3.5 (A:1-155) Calicheamicin gene cluster protein CalC {Micromonospora echinospora [TaxId: 1877]} nydpfvrhsvtvkadrktafktflegfpewwpnnfrttkvgaplgvdkkggrwyeideqg eehtfglirkvdepdtlvigwrlngfgridpdnsseftvtfvadgqkktrvdvehthfdr mgtkhakrvrngmdkgwptilqsfqdkideegakk
Timeline for d1zxfa1: