PDB entry 1zxf

View 1zxf on RCSB PDB site
Description: Solution structure of a self-sacrificing resistance protein, CalC from Micromonospora echinospora
Class: toxin
Keywords: Self-Sacrificing Resistance Protein, Structural Genomics, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2005-06-08, released 2005-12-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-22, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CalC
    Species: Micromonospora echinospora
    Gene: CalC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zxfa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zxfA (A:)
nydpfvrhsvtvkadrktafktflegfpewwpnnfrttkvgaplgvdkkggrwyeideqg
eehtfglirkvdepdtlvigwrlngfgridpdnsseftvtfvadgqkktrvdvehthfdr
mgtkhakrvrngmdkgwptilqsfqdkideegakk