Lineage for d1zxfa1 (1zxf A:1-155)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539012Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2539232Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
    Pfam PF05146
  6. 2539236Protein Calicheamicin gene cluster protein CalC [143831] (1 species)
    possible link between the AHSA1 (Pfam PF08327) and oligoketide cyclase/dehydrase-like (new Pfam PF03364) families
  7. 2539237Species Micromonospora echinospora [TaxId:1877] [143832] (4 PDB entries)
    Uniprot Q8KNF0 27-181
  8. 2539239Domain d1zxfa1: 1zxf A:1-155 [125771]

Details for d1zxfa1

PDB Entry: 1zxf (more details)

PDB Description: Solution structure of a self-sacrificing resistance protein, CalC from Micromonospora echinospora
PDB Compounds: (A:) CalC

SCOPe Domain Sequences for d1zxfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxfa1 d.129.3.5 (A:1-155) Calicheamicin gene cluster protein CalC {Micromonospora echinospora [TaxId: 1877]}
nydpfvrhsvtvkadrktafktflegfpewwpnnfrttkvgaplgvdkkggrwyeideqg
eehtfglirkvdepdtlvigwrlngfgridpdnsseftvtfvadgqkktrvdvehthfdr
mgtkhakrvrngmdkgwptilqsfqdkideegakk

SCOPe Domain Coordinates for d1zxfa1:

Click to download the PDB-style file with coordinates for d1zxfa1.
(The format of our PDB-style files is described here.)

Timeline for d1zxfa1: