SCOP 1.75: Domain d1zxfa1: 1zxf A:1-155

Lineage for d1zxfa1 (1zxf A:1-155)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (10 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (11 proteins)
   Pfam PF05146

6. Protein Calicheamicin gene cluster protein CalC [143831] (1 species)
   possible link between the AHSA1 (Pfam PF08327) and oligoketide cyclase/dehydrase-like (new Pfam PF03364) families

7. Species Micromonospora echinospora [TaxId:1877] [143832] (3 PDB entries)
   Uniprot Q8KNF0 27-181

8. Domain d1zxfa1: 1zxf A:1-155 [125771]

Details for d1zxfa1

PDB Entry: 1zxf

PDB Description: solution structure of a self-sacrificing resistance protein, calc from micromonospora echinospora

PDB Compounds: (A:) CalC

SCOP Domain Sequences for d1zxfa1:

Sequence; same for both SEQRES and ATOM records:

>d1zxfa1 d.129.3.5 (A:1-155) Calicheamicin gene cluster protein CalC {Micromonospora echinospora [TaxId: 1877]}
nydpfvrhsvtvkadrktafktflegfpewwpnnfrttkvgaplgvdkkggrwyeideqg
eehtfglirkvdepdtlvigwrlngfgridpdnsseftvtfvadgqkktrvdvehthfdr
mgtkhakrvrngmdkgwptilqsfqdkideegakk

Timeline for d1zxfa1:

• d1zxfa1 first appeared in SCOP 1.73
  
• d1zxfa1 appears in SCOPe 2.01
  
• d1zxfa1 appears in the current release, SCOPe 2.08