SCOPe 2.04: Domain d1zx8c_: 1zx8 C:

Lineage for d1zx8c_ (1zx8 C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.3: TM1367-like [141519] (2 proteins)
   Pfam PF04126; DUF369

6. Protein Hypothetical protein TM1367 [141520] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [141521] (1 PDB entry)
   Uniprot Q9X187 1-124

8. Domain d1zx8c_: 1zx8 C: [125766]
   automated match to d1zx8a1
   complexed with 1pe, ni

Details for d1zx8c_

PDB Entry: 1zx8, 1.9 Å

PDB Description: crystal structure of an atypical cyclophilin (peptidylprolyl cis-trans isomerase) (tm1367) from thermotoga maritima at 1.90 a resolution

PDB Compounds: (C:) hypothetical protein TM1367

SCOPe Domain Sequences for d1zx8c_:

Sequence; same for both SEQRES and ATOM records:

>d1zx8c_ b.62.1.3 (C:) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]}
hhhhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkme
nprevveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdge
kvavrfas

Timeline for d1zx8c_:

• d1zx8c_ first appeared in SCOP 1.73, called d1zx8c1
  
• d1zx8c_ appears in SCOPe 2.03
  
• d1zx8c_ appears in SCOPe 2.05
  
• d1zx8c_ appears in the current release, SCOPe 2.08, called d1zx8c2