Lineage for d1zx8c_ (1zx8 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1801476Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1801477Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1801828Family b.62.1.3: TM1367-like [141519] (2 proteins)
    Pfam PF04126; DUF369
  6. 1801829Protein Hypothetical protein TM1367 [141520] (1 species)
  7. 1801830Species Thermotoga maritima [TaxId:2336] [141521] (1 PDB entry)
    Uniprot Q9X187 1-124
  8. 1801833Domain d1zx8c_: 1zx8 C: [125766]
    automated match to d1zx8a1
    complexed with 1pe, ni

Details for d1zx8c_

PDB Entry: 1zx8 (more details), 1.9 Å

PDB Description: crystal structure of an atypical cyclophilin (peptidylprolyl cis-trans isomerase) (tm1367) from thermotoga maritima at 1.90 a resolution
PDB Compounds: (C:) hypothetical protein TM1367

SCOPe Domain Sequences for d1zx8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zx8c_ b.62.1.3 (C:) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]}
hhhhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkme
nprevveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdge
kvavrfas

SCOPe Domain Coordinates for d1zx8c_:

Click to download the PDB-style file with coordinates for d1zx8c_.
(The format of our PDB-style files is described here.)

Timeline for d1zx8c_: