![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.3: TM1367-like [141519] (2 proteins) Pfam PF04126; DUF369 |
![]() | Protein Hypothetical protein TM1367 [141520] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [141521] (1 PDB entry) Uniprot Q9X187 1-124 |
![]() | Domain d1zx8c2: 1zx8 C:1-123 [125766] Other proteins in same PDB: d1zx8a2, d1zx8b3, d1zx8c3 automated match to d1zx8a1 complexed with 1pe, ni |
PDB Entry: 1zx8 (more details), 1.9 Å
SCOPe Domain Sequences for d1zx8c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zx8c2 b.62.1.3 (C:1-123) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]} mrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkmenprev veigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdgekvavr fas
Timeline for d1zx8c2:
![]() Domains from other chains: (mouse over for more information) d1zx8a1, d1zx8a2, d1zx8b2, d1zx8b3 |