SCOPe 2.04: Domain d1zvca1: 1zvc A:20-193

Lineage for d1zvca1 (1zvc A:20-193)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.159: AOC barrel-like [141492] (2 superfamilies)
   barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds

4. Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families)

5. Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
   Pfam PF06351

6. Protein Allene oxide cyclase, AOC [141495] (2 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast AOC1 [TaxId:3702] [141497] (1 PDB entry)
   Uniprot Q9LS03 81-254

8. Domain d1zvca1: 1zvc A:20-193 [125705]
   complexed with mg

Details for d1zvca1

PDB Entry: 1zvc, 1.79 Å

PDB Description: x-ray structure of allene oxide cyclase from arabidopsis thaliana at3g25760

PDB Compounds: (A:) allene oxide cyclase

SCOPe Domain Sequences for d1zvca1:

Sequence, based on SEQRES records:

>d1zvca1 b.159.1.1 (A:20-193) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC1 [TaxId: 3702]}
kvqelsvyeindldrhspkilknafsfrfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekngdrfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleligtpvppskdvepapeakalkpsgvvsnftn

Sequence, based on observed residues (ATOM records):

>d1zvca1 b.159.1.1 (A:20-193) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC1 [TaxId: 3702]}
kvqelsvyeindldrhspkilknarfglgdlvpftnklytgdlkkrvgitaglcvviehv
pekngdrfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlvyp
tklfytfylkglandlpleligtpvppskdvepapeakalkpsgvvsnftn

Timeline for d1zvca1:

• d1zvca1 first appeared in SCOP 1.73
  
• d1zvca1 appears in SCOPe 2.03
  
• d1zvca1 appears in SCOPe 2.05
  
• d1zvca1 appears in the current release, SCOPe 2.08