PDB entry 1zvc

View 1zvc on RCSB PDB site
Description: X-ray structure of allene oxide cyclase from arabidopsis thaliana AT3G25760
Class: isomerase
Keywords: structural genomics, protein structure initiative, psi, at3g25760, center for eukaryotic structural genomics, cesg, isomerase
Deposited on 2005-06-01, released 2005-06-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.239
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allene oxide cyclase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT3G25760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1zvca1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zvcA (A:)
    slsqnlgntenprpskvqelsvyeindldrhspkilknafsfrfglgdlvpftnklytgd
    lkkrvgitaglcvviehvpekngdrfeatysfyfgdyghlsvqgpyltyedsflaitgga
    gifegaygqvklqqlvyptklfytfylkglandlpleligtpvppskdvepapeakalkp
    sgvvsnftn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zvcA (A:)
    kvqelsvyeindldrhspkilknarfglgdlvpftnklytgdlkkrvgitaglcvviehv
    pekngdrfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlvyp
    tklfytfylkglandlpleligtpvppskdvepapeakalkpsgvvsnftn