Lineage for d1zvca1 (1zvc A:20-193)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1814894Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 1814895Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) (S)
  5. 1814896Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
    Pfam PF06351
  6. 1814897Protein Allene oxide cyclase, AOC [141495] (2 species)
  7. 1814898Species Thale cress (Arabidopsis thaliana), chloroplast AOC1 [TaxId:3702] [141497] (1 PDB entry)
    Uniprot Q9LS03 81-254
  8. 1814899Domain d1zvca1: 1zvc A:20-193 [125705]
    complexed with mg

Details for d1zvca1

PDB Entry: 1zvc (more details), 1.79 Å

PDB Description: x-ray structure of allene oxide cyclase from arabidopsis thaliana at3g25760
PDB Compounds: (A:) allene oxide cyclase

SCOPe Domain Sequences for d1zvca1:

Sequence, based on SEQRES records: (download)

>d1zvca1 b.159.1.1 (A:20-193) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC1 [TaxId: 3702]}
kvqelsvyeindldrhspkilknafsfrfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekngdrfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleligtpvppskdvepapeakalkpsgvvsnftn

Sequence, based on observed residues (ATOM records): (download)

>d1zvca1 b.159.1.1 (A:20-193) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC1 [TaxId: 3702]}
kvqelsvyeindldrhspkilknarfglgdlvpftnklytgdlkkrvgitaglcvviehv
pekngdrfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlvyp
tklfytfylkglandlpleligtpvppskdvepapeakalkpsgvvsnftn

SCOPe Domain Coordinates for d1zvca1:

Click to download the PDB-style file with coordinates for d1zvca1.
(The format of our PDB-style files is described here.)

Timeline for d1zvca1: