![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.262: PriB N-terminal domain-like [140913] (1 superfamily) multihelical bundle; contains buried central helix; also includes the PriA interface-forming insert subdomain (alpha+beta) |
![]() | Superfamily a.262.1: PriB N-terminal domain-like [140914] (1 family) ![]() |
![]() | Family a.262.1.1: PriB N-terminal domain-like [140915] (2 proteins) |
![]() | Protein DNA primase large subunit PriB, N-terminal domain [140916] (1 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [140917] (1 PDB entry) Uniprot Q9UWW1 3-206 |
![]() | Domain d1zt2d1: 1zt2 D:3-209 [125626] Other proteins in same PDB: d1zt2a1 automatically matched to 1ZT2 B:3-209 complexed with so4, zn |
PDB Entry: 1zt2 (more details), 3.33 Å
SCOPe Domain Sequences for d1zt2d1:
Sequence, based on SEQRES records: (download)
>d1zt2d1 a.262.1.1 (D:3-209) DNA primase large subunit PriB, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} ldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsyne pvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrcdp ikfylekkrriiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqligliaes ikskivemirplnlkeipeklkslier
>d1zt2d1 a.262.1.1 (D:3-209) DNA primase large subunit PriB, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} ldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsyne pvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrcdp ikfyiiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqligliaesikskiv emirplnlkeipeklkslier
Timeline for d1zt2d1: