Lineage for d1zt2d1 (1zt2 D:3-209)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651857Fold a.262: PriB N-terminal domain-like [140913] (1 superfamily)
    multihelical bundle; contains buried central helix; also includes the PriA interface-forming insert subdomain (alpha+beta)
  4. 651858Superfamily a.262.1: PriB N-terminal domain-like [140914] (1 family) (S)
  5. 651859Family a.262.1.1: PriB N-terminal domain-like [140915] (1 protein)
  6. 651860Protein DNA primase large subunit PriB, N-terminal domain [140916] (1 species)
  7. 651861Species Sulfolobus solfataricus [TaxId:2287] [140917] (1 PDB entry)
  8. 651863Domain d1zt2d1: 1zt2 D:3-209 [125626]
    Other proteins in same PDB: d1zt2a1
    automatically matched to 1ZT2 B:3-209
    complexed with so4, zn

Details for d1zt2d1

PDB Entry: 1zt2 (more details), 3.33 Å

PDB Description: Heterodimeric structure of the core primase.
PDB Compounds: (D:) DNA primase large subunit

SCOP Domain Sequences for d1zt2d1:

Sequence, based on SEQRES records: (download)

>d1zt2d1 a.262.1.1 (D:3-209) DNA primase large subunit PriB, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
ldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsyne
pvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrcdp
ikfylekkrriiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqligliaes
ikskivemirplnlkeipeklkslier

Sequence, based on observed residues (ATOM records): (download)

>d1zt2d1 a.262.1.1 (D:3-209) DNA primase large subunit PriB, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
ldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsyne
pvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrcdp
ikfyiiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqligliaesikskiv
emirplnlkeipeklkslier

SCOP Domain Coordinates for d1zt2d1:

Click to download the PDB-style file with coordinates for d1zt2d1.
(The format of our PDB-style files is described here.)

Timeline for d1zt2d1: