PDB entry 1zt2

View 1zt2 on RCSB PDB site
Description: Heterodimeric structure of the core primase.
Class: replication, transferase
Keywords: Heterodimeric complex, replication, transferase
Deposited on 2005-05-26, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.33 Å
R-factor: 0.236
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA primase small subunit
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: priA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zt2a1
  • Chain 'B':
    Compound: DNA primase large subunit
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: priB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zt2b1
  • Chain 'C':
    Compound: DNA primase small subunit
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: priA
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA primase large subunit
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: priB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zt2d1
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zt2A (A:)
    mgtftlhqgqtnliksffrnyylnaelelpkdmelrefalqpfgsdtyvrhlsfssseel
    rdylvnrnlplhlfyssaryqlpsarnmeekawmgsdllfdidadhlcklrsirfcpvcg
    navvsekcerdnvetleyvemtsecikrgleqtrnlveileddfglkpkvyfsgnrgfhv
    qvdcygncalldsderkeiaeyvmgigvpgypggsenapgwvgrknrgingvtideqvti
    dvkrliripnslhgksglivkrvpnlddfefnetlspftgytiflpyitietevlgsiik
    lnrgipikikssigiylhlrnlgevkayvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zt2A (A:)
    tftlhqgqtnliksffrnyylnaelelpkdmelrefalqpfgsdtyvrhlsfssseelrd
    ylvnrnlplhlfyssaryqlpsarnmeekawmgsdllfdidadhlcklrsirfcpvcgna
    vvsekcerdnvetleyvemtsecikrgleqtrnlveileddfglkpkvyfsgnrgfhvqv
    dcygncalldsderkeiaeyvmgigvpgypggsenapgwvgrknrgingvtideqvtidv
    krliripnslhgksglivkrvpnlddfefnetlspftgytiflpyitietevlgsiikln
    rgipikikssigiylhlrnlgevkayv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zt2B (B:)
    maldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsy
    nepvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrc
    dpikfylekkrriiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqliglia
    esikskivemirplnlkeipeklkslierrgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zt2B (B:)
    ldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsyne
    pvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrcdp
    ikfylekkrriiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqligliaes
    ikskivemirplnlkeipeklkslier
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zt2D (D:)
    maldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsy
    nepvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrc
    dpikfylekkrriiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqliglia
    esikskivemirplnlkeipeklkslierrgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zt2D (D:)
    aldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsyn
    epvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrcd
    pikfyiiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqligliaesikski
    vemirplnlkeipeklkslier