SCOPe 2.06: Domain d1zpvc2: 1zpv C:1-86

Lineage for d1zpvc2 (1zpv C:1-86)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.7: SP0238-like [143381] (1 protein)
   stand-alone protein; dimer, the dimerization interface is formed by parallel packing of the subunit beta-sheets
   automatically mapped to Pfam PF13740

6. Protein UPF0237 protein SP0238 [143382] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143383] (1 PDB entry)
   Uniprot P67382 1-83

8. Domain d1zpvc2: 1zpv C:1-86 [125477]
   Other proteins in same PDB: d1zpva2, d1zpvb3, d1zpvc3
   automated match to d1zpva1
   complexed with k

Details for d1zpvc2

PDB Entry: 1zpv, 1.9 Å

PDB Description: ACT domain protein from Streptococcus pneumoniae

PDB Compounds: (C:) ACT domain protein

SCOPe Domain Sequences for d1zpvc2:

Sequence; same for both SEQRES and ATOM records:

>d1zpvc2 d.58.18.7 (C:1-86) UPF0237 protein SP0238 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdftylr
nefeafgqtlnvkiniqsaaifeamy

Timeline for d1zpvc2:

• d1zpvc2 first appeared in SCOP 1.73, called d1zpvc1
  
• d1zpvc2 was called d1zpvc_ in SCOPe 2.05
  
• d1zpvc2 appears in SCOPe 2.07
  
• d1zpvc2 appears in the current release, SCOPe 2.08