![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.7: SP0238-like [143381] (1 protein) stand-alone protein; dimer, the dimerization interface is formed by parallel packing of the subunit beta-sheets automatically mapped to Pfam PF13740 |
![]() | Protein UPF0237 protein SP0238 [143382] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143383] (1 PDB entry) Uniprot P67382 1-83 |
![]() | Domain d1zpvc2: 1zpv C:1-86 [125477] Other proteins in same PDB: d1zpva2, d1zpvb3, d1zpvc3 automated match to d1zpva1 complexed with k |
PDB Entry: 1zpv (more details), 1.9 Å
SCOPe Domain Sequences for d1zpvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zpvc2 d.58.18.7 (C:1-86) UPF0237 protein SP0238 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdftylr nefeafgqtlnvkiniqsaaifeamy
Timeline for d1zpvc2:
![]() Domains from other chains: (mouse over for more information) d1zpva1, d1zpva2, d1zpvb2, d1zpvb3 |