Lineage for d1zpvc_ (1zpv C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910214Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 1910329Family d.58.18.7: SP0238-like [143381] (1 protein)
    stand-alone protein; dimer, the dimerization interface is formed by parallel packing of the subunit beta-sheets
    automatically mapped to Pfam PF13740
  6. 1910330Protein UPF0237 protein SP0238 [143382] (1 species)
  7. 1910331Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143383] (1 PDB entry)
    Uniprot P67382 1-83
  8. 1910334Domain d1zpvc_: 1zpv C: [125477]
    automated match to d1zpva1
    complexed with k

Details for d1zpvc_

PDB Entry: 1zpv (more details), 1.9 Å

PDB Description: ACT domain protein from Streptococcus pneumoniae
PDB Compounds: (C:) ACT domain protein

SCOPe Domain Sequences for d1zpvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpvc_ d.58.18.7 (C:) UPF0237 protein SP0238 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
namkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdfty
lrnefeafgqtlnvkiniqsaaifeamy

SCOPe Domain Coordinates for d1zpvc_:

Click to download the PDB-style file with coordinates for d1zpvc_.
(The format of our PDB-style files is described here.)

Timeline for d1zpvc_: