Lineage for d1zm3f_ (1zm3 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000572Protein automated matches [190133] (8 species)
    not a true protein
  7. 3000653Species Pseudomonas aeruginosa [TaxId:287] [186856] (5 PDB entries)
  8. 3000665Domain d1zm3f_: 1zm3 F: [125315]
    Other proteins in same PDB: d1zm3a1, d1zm3a2, d1zm3a3, d1zm3a4, d1zm3a5, d1zm3c1, d1zm3c2, d1zm3c3, d1zm3c4, d1zm3c5, d1zm3e1, d1zm3e2, d1zm3e3, d1zm3e4, d1zm3e5
    automated match to d1zm9b_

Details for d1zm3f_

PDB Entry: 1zm3 (more details), 3.07 Å

PDB Description: Structure of the apo eEF2-ETA complex
PDB Compounds: (F:) exotoxin a

SCOPe Domain Sequences for d1zm3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm3f_ d.166.1.1 (F:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d1zm3f_:

Click to download the PDB-style file with coordinates for d1zm3f_.
(The format of our PDB-style files is described here.)

Timeline for d1zm3f_: