Lineage for d1zm3a5 (1zm3 A:726-842)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953573Family d.58.11.0: automated matches [254210] (1 protein)
    not a true family
  6. 2953574Protein automated matches [254469] (4 species)
    not a true protein
  7. 2953577Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255012] (4 PDB entries)
  8. 2953585Domain d1zm3a5: 1zm3 A:726-842 [125302]
    Other proteins in same PDB: d1zm3a1, d1zm3a2, d1zm3a3, d1zm3b_, d1zm3c1, d1zm3c2, d1zm3c3, d1zm3d_, d1zm3e1, d1zm3e2, d1zm3e3, d1zm3f_
    automated match to d1n0ua5

Details for d1zm3a5

PDB Entry: 1zm3 (more details), 3.07 Å

PDB Description: Structure of the apo eEF2-ETA complex
PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d1zm3a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm3a5 d.58.11.0 (A:726-842) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOPe Domain Coordinates for d1zm3a5:

Click to download the PDB-style file with coordinates for d1zm3a5.
(The format of our PDB-style files is described here.)

Timeline for d1zm3a5: