SCOPe 2.08: Domain d1zlqb_: 1zlq B:

Lineage for d1zlqb_ (1zlq B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
   similar domain organization to oligo- and dipeptide-binding protein

7. Species Escherichia coli [TaxId:562] [102695] (28 PDB entries)

8. Domain d1zlqb_: 1zlq B: [125254]
   automated match to d1uiva_
   complexed with act, cl, dtt, edt, fe, gol, so4
   has additional subdomain(s) that are not in the common domain

Details for d1zlqb_

PDB Entry: 1zlq, 1.8 Å

PDB Description: Crystallographic and spectroscopic evidence for high affinity binding of Fe EDTA (H2O)- to the periplasmic nickel transporter NikA

PDB Compounds: (B:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d1zlqb_:

Sequence; same for both SEQRES and ATOM records:

>d1zlqb_ c.94.1.1 (B:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
apdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgk
twtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqit
lksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrn
enywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtq
lsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpya
nlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiq
admrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqa
qqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelg
nipyapiateipfeqikpv

Timeline for d1zlqb_:

• d1zlqb_ first appeared in SCOP 1.73, called d1zlqb1
  
• d1zlqb_ appears in SCOPe 2.07