SCOPe 2.01: Domain d1zl3a2: 1zl3 A:10-250

Lineage for d1zl3a2 (1zl3 A:10-250)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (4 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.2: Pseudouridine synthase II TruB [69746] (1 protein)
   contains C-terminal PUA domain

6. Protein Pseudouridine synthase II TruB [69747] (5 species)

7. Species Escherichia coli [TaxId:562] [69748] (3 PDB entries)

8. Domain d1zl3a2: 1zl3 A:10-250 [125236]
   Other proteins in same PDB: d1zl3a1
   automatically matched to d1r3fa2
   protein/RNA complex; complexed with so4

Details for d1zl3a2

PDB Entry: 1zl3, 2.8 Å

PDB Description: coupling of active site motions and rna binding

PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1zl3a2:

Sequence; same for both SEQRES and ATOM records:

>d1zl3a2 d.265.1.2 (A:10-250) Pseudouridine synthase II TruB {Escherichia coli [TaxId: 562]}
dingvllldkpqgmssndalqkvkriynanraghtgalnplatgmlpiclgeatkfsqyl
ldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipsmysal
kyqgkklyeyarqgievprearpitvyellfirhegneleleihcskgtyirtiiddlge
klgcgahviylrrlavskypvermvtlehlrelveqaeqqdipaaelldpllmpmdspas
d

Timeline for d1zl3a2:

• d1zl3a2 first appeared in SCOP 1.73
  
• d1zl3a2 appears in SCOP 1.75
  
• d1zl3a2 appears in SCOPe 2.02
  
• d1zl3a2 appears in the current release, SCOPe 2.08