Lineage for d1zl3a2 (1zl3 A:10-250)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009172Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 3009173Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 3009188Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
    contains C-terminal PUA domain
  6. 3009189Protein Pseudouridine synthase II TruB [69747] (5 species)
  7. 3009190Species Escherichia coli [TaxId:562] [69748] (3 PDB entries)
  8. 3009193Domain d1zl3a2: 1zl3 A:10-250 [125236]
    Other proteins in same PDB: d1zl3a1, d1zl3a3
    automated match to d1r3fa2
    protein/RNA complex; complexed with so4

Details for d1zl3a2

PDB Entry: 1zl3 (more details), 2.8 Å

PDB Description: coupling of active site motions and rna binding
PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1zl3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zl3a2 d.265.1.2 (A:10-250) Pseudouridine synthase II TruB {Escherichia coli [TaxId: 562]}
dingvllldkpqgmssndalqkvkriynanraghtgalnplatgmlpiclgeatkfsqyl
ldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipsmysal
kyqgkklyeyarqgievprearpitvyellfirhegneleleihcskgtyirtiiddlge
klgcgahviylrrlavskypvermvtlehlrelveqaeqqdipaaelldpllmpmdspas
d

SCOPe Domain Coordinates for d1zl3a2:

Click to download the PDB-style file with coordinates for d1zl3a2.
(The format of our PDB-style files is described here.)

Timeline for d1zl3a2: