SCOPe 2.08: Domain d1zl0a2: 1zl0 A:3-169

Lineage for d1zl0a2 (1zl0 A:3-169)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.7: LD-carboxypeptidase A N-terminal domain-like [142074] (1 protein)
   N-terminal half of Pfam PF02016

6. Protein LD-carboxypeptidase A, N-terminal domain [142075] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142076] (4 PDB entries)
   Uniprot Q9HTZ1 3-169! Uniprot Q9HTZ1 5-142! Uniprot Q9HTZ1 5-169

8. Domain d1zl0a2: 1zl0 A:3-169 [125232]
   Other proteins in same PDB: d1zl0a1, d1zl0a3, d1zl0b1, d1zl0b3
   complexed with edo, gol, k, na, peg, tla

Details for d1zl0a2

PDB Entry: 1zl0, 1.1 Å

PDB Description: Structure of Protein of Unknown Function PA5198 from Pseudomonas aeruginosa

PDB Compounds: (A:) hypothetical protein PA5198

SCOPe Domain Sequences for d1zl0a2:

Sequence; same for both SEQRES and ATOM records:

>d1zl0a2 c.23.16.7 (A:3-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
srpssdqtwqpidgrvaliapasaiatdvleatlrqlevhgvdyhlgrhvearyrylagt
veqrledlhnafdmpditavwclrggygcgqllpgldwgrlqaasprpligfsdisvlls
afhrhglpaihgpvatglglsplsapreqqerlaslasvsrllagid

Timeline for d1zl0a2:

• d1zl0a2 first appeared in SCOP 1.73
  
• d1zl0a2 appears in SCOPe 2.07