![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.10: LD-carboxypeptidase A C-terminal domain-like [141986] (1 family) ![]() |
![]() | Family c.8.10.1: LD-carboxypeptidase A C-terminal domain-like [141987] (1 protein) C-terminal half of Pfam PF02016 |
![]() | Protein LD-carboxypeptidase A, C-terminal domain [141988] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [141989] (4 PDB entries) Uniprot Q9HTZ1 152-307! Uniprot Q9HTZ1 170-307 |
![]() | Domain d1zl0b1: 1zl0 B:170-307 [125233] Other proteins in same PDB: d1zl0a2, d1zl0a3, d1zl0b2, d1zl0b3 automated match to d1zl0a1 complexed with edo, gol, k, na, peg, tla |
PDB Entry: 1zl0 (more details), 1.1 Å
SCOPe Domain Sequences for d1zl0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zl0b1 c.8.10.1 (B:170-307) LD-carboxypeptidase A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} helpvqhlgghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlers lwqllesidarqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqn rawpygktavlegnrlrw
Timeline for d1zl0b1: