SCOPe 2.08: Domain d1zl0b1: 1zl0 B:170-307

Lineage for d1zl0b1 (1zl0 B:170-307)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.10: LD-carboxypeptidase A C-terminal domain-like [141986] (1 family)

5. Family c.8.10.1: LD-carboxypeptidase A C-terminal domain-like [141987] (1 protein)
   C-terminal half of Pfam PF02016

6. Protein LD-carboxypeptidase A, C-terminal domain [141988] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141989] (4 PDB entries)
   Uniprot Q9HTZ1 152-307! Uniprot Q9HTZ1 170-307

8. Domain d1zl0b1: 1zl0 B:170-307 [125233]
   Other proteins in same PDB: d1zl0a2, d1zl0a3, d1zl0b2, d1zl0b3
   automated match to d1zl0a1
   complexed with edo, gol, k, na, peg, tla

Details for d1zl0b1

PDB Entry: 1zl0, 1.1 Å

PDB Description: Structure of Protein of Unknown Function PA5198 from Pseudomonas aeruginosa

PDB Compounds: (B:) hypothetical protein PA5198

SCOPe Domain Sequences for d1zl0b1:

Sequence; same for both SEQRES and ATOM records:

>d1zl0b1 c.8.10.1 (B:170-307) LD-carboxypeptidase A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
helpvqhlgghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlers
lwqllesidarqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqn
rawpygktavlegnrlrw

Timeline for d1zl0b1:

• d1zl0b1 first appeared in SCOP 1.73
  
• d1zl0b1 appears in SCOPe 2.07