PDB entry 1zl0

View 1zl0 on RCSB PDB site
Description: Structure of Protein of Unknown Function PA5198 from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: structural genomics, hypothetical protein, PA5198, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-05-04, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.099
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA5198
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5198
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTZ1 (Start-308)
      • cloning artifact (309)
    Domains in SCOPe 2.07: d1zl0a1, d1zl0a2, d1zl0a3
  • Chain 'B':
    Compound: hypothetical protein PA5198
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5198
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTZ1 (Start-308)
      • cloning artifact (309-310)
    Domains in SCOPe 2.07: d1zl0b1, d1zl0b2, d1zl0b3
  • Heterogens: K, NA, TLA, EDO, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zl0A (A:)
    ghmtsrpssdqtwqpidgrvaliapasaiatdvleatlrqlevhgvdyhlgrhvearyry
    lagtveqrledlhnafdmpditavwclrggygcgqllpgldwgrlqaasprpligfsdis
    vllsafhrhglpaihgpvatglglsplsapreqqerlaslasvsrllagidhelpvqhlg
    ghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlerslwqllesid
    arqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqnrawpygkta
    vlegnrlrwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zl0A (A:)
    srpssdqtwqpidgrvaliapasaiatdvleatlrqlevhgvdyhlgrhvearyrylagt
    veqrledlhnafdmpditavwclrggygcgqllpgldwgrlqaasprpligfsdisvlls
    afhrhglpaihgpvatglglsplsapreqqerlaslasvsrllagidhelpvqhlgghkq
    rvegaliggnltalacmagtlgglhapagsilvledvgepyyrlerslwqllesidarql
    gaiclgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqnrawpygktavleg
    nrlrwg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zl0B (B:)
    ghmtsrpssdqtwqpidgrvaliapasaiatdvleatlrqlevhgvdyhlgrhvearyry
    lagtveqrledlhnafdmpditavwclrggygcgqllpgldwgrlqaasprpligfsdis
    vllsafhrhglpaihgpvatglglsplsapreqqerlaslasvsrllagidhelpvqhlg
    ghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlerslwqllesid
    arqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqnrawpygkta
    vlegnrlrwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zl0B (B:)
    sdqtwqpidgrvaliapasaiatdvleatlrqlevhgvdyhlgrhvearyrylagtveqr
    ledlhnafdmpditavwclrggygcgqllpgldwgrlqaasprpligfsdisvllsafhr
    hglpaihgpvatglglsplsapreqqerlaslasvsrllagidhelpvqhlgghkqrveg
    aliggnltalacmagtlgglhapagsilvledvgepyyrlerslwqllesidarqlgaic
    lgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqnrawpygktavlegnrlr
    wgs