Lineage for d1zl0b2 (1zl0 B:7-169)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859218Family c.23.16.7: LD-carboxypeptidase A N-terminal domain-like [142074] (1 protein)
    N-terminal half of Pfam PF02016
  6. 2859219Protein LD-carboxypeptidase A, N-terminal domain [142075] (1 species)
  7. 2859220Species Pseudomonas aeruginosa [TaxId:287] [142076] (4 PDB entries)
    Uniprot Q9HTZ1 3-169! Uniprot Q9HTZ1 5-142! Uniprot Q9HTZ1 5-169
  8. 2859222Domain d1zl0b2: 1zl0 B:7-169 [125234]
    Other proteins in same PDB: d1zl0a1, d1zl0a3, d1zl0b1, d1zl0b3
    automated match to d1zl0a2
    complexed with edo, gol, k, na, peg, tla

Details for d1zl0b2

PDB Entry: 1zl0 (more details), 1.1 Å

PDB Description: Structure of Protein of Unknown Function PA5198 from Pseudomonas aeruginosa
PDB Compounds: (B:) hypothetical protein PA5198

SCOPe Domain Sequences for d1zl0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zl0b2 c.23.16.7 (B:7-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
sdqtwqpidgrvaliapasaiatdvleatlrqlevhgvdyhlgrhvearyrylagtveqr
ledlhnafdmpditavwclrggygcgqllpgldwgrlqaasprpligfsdisvllsafhr
hglpaihgpvatglglsplsapreqqerlaslasvsrllagid

SCOPe Domain Coordinates for d1zl0b2:

Click to download the PDB-style file with coordinates for d1zl0b2.
(The format of our PDB-style files is described here.)

Timeline for d1zl0b2: