![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.9: YhfI-like [143924] (1 protein) part of Pfam PF00753 |
![]() | Protein Hypothetical protein BA1088 (BAS1016) [143925] (1 species) B. subtilis YhfI ortholog |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [143926] (1 PDB entry) Uniprot Q81U06 1-244 |
![]() | Domain d1zkpb2: 1zkp B:0-244 [125206] Other proteins in same PDB: d1zkpa2, d1zkpb3, d1zkpc3, d1zkpd3 automated match to d1zkpa1 complexed with cl, na, zn |
PDB Entry: 1zkp (more details), 1.5 Å
SCOPe Domain Sequences for d1zkpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zkpb2 d.157.1.9 (B:0-244) Hypothetical protein BA1088 (BAS1016) {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} amkmtvvgfwggfpeageatsgylfehdgfrllvdcgsgvlaqlqkyitpsdidavvlsh yhhdhvadigvlqyarlitsatkgqlpelpiyghtfdengfhslthephtkgipynpeet lqigpfsisflktvhpvtcfamritagndivvysadssyipefipftkdadlficecnmy ahqeaakaghmnstevasiakdanvkelllthlphtgnpadlvteakqifsghitlahsg yvwns
Timeline for d1zkpb2: