Lineage for d1zkpd2 (1zkp D:1-244)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997175Family d.157.1.9: YhfI-like [143924] (1 protein)
    part of Pfam PF00753
  6. 2997176Protein Hypothetical protein BA1088 (BAS1016) [143925] (1 species)
    B. subtilis YhfI ortholog
  7. 2997177Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [143926] (1 PDB entry)
    Uniprot Q81U06 1-244
  8. 2997181Domain d1zkpd2: 1zkp D:1-244 [125208]
    Other proteins in same PDB: d1zkpa2, d1zkpb3, d1zkpc3, d1zkpd3
    automated match to d1zkpa1
    complexed with cl, na, zn

Details for d1zkpd2

PDB Entry: 1zkp (more details), 1.5 Å

PDB Description: 1.5a resolution crystal structure of a metallo beta lactamase family protein, the elac homolgue of bacillus anthracis, a putative ribonuclease
PDB Compounds: (D:) hypothetical protein BA1088

SCOPe Domain Sequences for d1zkpd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkpd2 d.157.1.9 (D:1-244) Hypothetical protein BA1088 (BAS1016) {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mkmtvvgfwggfpeageatsgylfehdgfrllvdcgsgvlaqlqkyitpsdidavvlshy
hhdhvadigvlqyarlitsatkgqlpelpiyghtfdengfhslthephtkgipynpeetl
qigpfsisflktvhpvtcfamritagndivvysadssyipefipftkdadlficecnmya
hqeaakaghmnstevasiakdanvkelllthlphtgnpadlvteakqifsghitlahsgy
vwns

SCOPe Domain Coordinates for d1zkpd2:

Click to download the PDB-style file with coordinates for d1zkpd2.
(The format of our PDB-style files is described here.)

Timeline for d1zkpd2: