SCOP 1.73: Domain d1zkpb1: 1zkp B:1-244

Lineage for d1zkpb1 (1zkp B:1-244)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families)

5. Family d.157.1.9: YhfI-like [143924] (1 protein)
   part of Pfam PF00753

6. Protein Hypothetical protein BA1088 (BAS1016) [143925] (1 species)
   B. subtilis YhfI ortholog

7. Species Bacillus anthracis [TaxId:1392] [143926] (1 PDB entry)

8. Domain d1zkpb1: 1zkp B:1-244 [125206]
   automatically matched to 1ZKP A:1-244
   complexed with cl, na, zn

Details for d1zkpb1

PDB Entry: 1zkp, 1.5 Å

PDB Description: 1.5a resolution crystal structure of a metallo beta lactamase family protein, the elac homolgue of bacillus anthracis, a putative ribonuclease

PDB Compounds: (B:) hypothetical protein BA1088

SCOP Domain Sequences for d1zkpb1:

Sequence; same for both SEQRES and ATOM records:

>d1zkpb1 d.157.1.9 (B:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]}
mkmtvvgfwggfpeageatsgylfehdgfrllvdcgsgvlaqlqkyitpsdidavvlshy
hhdhvadigvlqyarlitsatkgqlpelpiyghtfdengfhslthephtkgipynpeetl
qigpfsisflktvhpvtcfamritagndivvysadssyipefipftkdadlficecnmya
hqeaakaghmnstevasiakdanvkelllthlphtgnpadlvteakqifsghitlahsgy
vwns

Timeline for d1zkpb1:

• d1zkpb1 is new in SCOP 1.73
  
• d1zkpb1 appears in SCOP 1.75
  
• d1zkpb1 appears in the current release, SCOPe 2.08, called d1zkpb2