Lineage for d1zk3e1 (1zk3 E:1-251)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 687057Protein R-specific alcohol dehydrogenase [89521] (1 species)
  7. 687058Species Lactobacillus brevis [TaxId:1580] [89522] (8 PDB entries)
  8. 687070Domain d1zk3e1: 1zk3 E:1-251 [125172]
    automatically matched to 1ZJY A:1-251
    complexed with mg; mutant

Details for d1zk3e1

PDB Entry: 1zk3 (more details), 2.2 Å

PDB Description: triclinic crystal structure of the apo-form of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis
PDB Compounds: (E:) R-specific alcohol dehydrogenase

SCOP Domain Sequences for d1zk3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zk3e1 c.2.1.2 (E:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}
snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
efvvdggytaq

SCOP Domain Coordinates for d1zk3e1:

Click to download the PDB-style file with coordinates for d1zk3e1.
(The format of our PDB-style files is described here.)

Timeline for d1zk3e1: