PDB entry 1zk3

View 1zk3 on RCSB PDB site
Description: Triclinic crystal structure of the apo-form of R-specific alcohol dehydrogenase (mutant G37D) from Lactobacillus brevis
Class: oxidoreductase
Keywords: short chain reductases/dehydrogenases, magnesium dependence, R-specific alcohol dehydrogenase
Deposited on 2005-05-02, released 2005-06-21
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: R-specific alcohol dehydrogenase
    Species: Lactobacillus brevis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84EX5 (0-250)
      • engineered (36)
    Domains in SCOP 1.73: d1zk3a1
  • Chain 'B':
    Compound: R-specific alcohol dehydrogenase
    Species: Lactobacillus brevis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84EX5 (0-250)
      • engineered (36)
    Domains in SCOP 1.73: d1zk3b1
  • Chain 'C':
    Compound: R-specific alcohol dehydrogenase
    Species: Lactobacillus brevis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84EX5 (0-250)
      • engineered (36)
    Domains in SCOP 1.73: d1zk3c1
  • Chain 'D':
    Compound: R-specific alcohol dehydrogenase
    Species: Lactobacillus brevis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84EX5 (0-250)
      • engineered (36)
    Domains in SCOP 1.73: d1zk3d1
  • Chain 'E':
    Compound: R-specific alcohol dehydrogenase
    Species: Lactobacillus brevis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84EX5 (0-250)
      • engineered (36)
    Domains in SCOP 1.73: d1zk3e1
  • Chain 'F':
    Compound: R-specific alcohol dehydrogenase
    Species: Lactobacillus brevis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84EX5 (0-250)
      • engineered (36)
    Domains in SCOP 1.73: d1zk3f1
  • Chain 'G':
    Compound: R-specific alcohol dehydrogenase
    Species: Lactobacillus brevis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84EX5 (0-250)
      • engineered (36)
    Domains in SCOP 1.73: d1zk3g1
  • Chain 'H':
    Compound: R-specific alcohol dehydrogenase
    Species: Lactobacillus brevis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84EX5 (0-250)
      • engineered (36)
    Domains in SCOP 1.73: d1zk3h1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zk3A (A:)
    snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zk3B (B:)
    snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zk3C (C:)
    snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zk3D (D:)
    snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zk3E (E:)
    snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zk3F (F:)
    snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zk3G (G:)
    snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zk3H (H:)
    snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq