Lineage for d1zgnb2 (1zgn B:2-77)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168697Protein Class pi GST [81358] (4 species)
  7. 1168698Species Human (Homo sapiens) [TaxId:9606] [52864] (41 PDB entries)
  8. 1168734Domain d1zgnb2: 1zgn B:2-77 [125058]
    Other proteins in same PDB: d1zgna1, d1zgnb1
    automatically matched to d1gssa2
    complexed with fe, gsh, mes, no

Details for d1zgnb2

PDB Entry: 1zgn (more details), 2.1 Å

PDB Description: crystal structure of the glutathione transferase pi in complex with dinitrosyl-diglutathionyl iron complex
PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d1zgnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgnb2 c.47.1.5 (B:2-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtlg

SCOPe Domain Coordinates for d1zgnb2:

Click to download the PDB-style file with coordinates for d1zgnb2.
(The format of our PDB-style files is described here.)

Timeline for d1zgnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zgnb1