SCOPe 2.02: Domain d1zgna1: 1zgn A:78-209

Lineage for d1zgna1 (1zgn A:78-209)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (41 PDB entries)

8. Domain d1zgna1: 1zgn A:78-209 [125055]
   Other proteins in same PDB: d1zgna2, d1zgnb2
   automatically matched to d10gsa1
   complexed with fe, gsh, mes, no

Details for d1zgna1

PDB Entry: 1zgn, 2.1 Å

PDB Description: crystal structure of the glutathione transferase pi in complex with dinitrosyl-diglutathionyl iron complex

PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d1zgna1:

Sequence; same for both SEQRES and ATOM records:

>d1zgna1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
lygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqnq
ggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspe
yvnlpingngkq

Timeline for d1zgna1:

• d1zgna1 first appeared in SCOP 1.73
  
• d1zgna1 appears in SCOPe 2.01
  
• d1zgna1 appears in SCOPe 2.03
  
• d1zgna1 appears in the current release, SCOPe 2.08